Recombinant Human C-C chemokine receptor type 4 (CCR4)-VLPs (Active)

Artikelnummer: CSB-MP004843HU
Artikelname: Recombinant Human C-C chemokine receptor type 4 (CCR4)-VLPs (Active)
Artikelnummer: CSB-MP004843HU
Hersteller Artikelnummer: CSB-MP004843HU
Alternativnummer: CSB-MP004843HU-1, CSB-MP004843HU-100, CSB-MP004843HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: K5-5 CD_antigen: CD194
Molekulargewicht: 43.2 kDa
Tag: C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
UniProt: P51679
Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4.
Quelle: Mammalian cell
Expression System: 1-360aa
Reinheit: The purity information is not available for VLPs proteins.
Formulierung: Lyophilized powder
Sequenz: MNPTDIADTTLDESIYSNYYLYESIPKPCTKEGIKAFGELFLPPLYSLVFVFGLLGNSVVVLVLFKYKRLRSMTDVYLLNLAISDLLFVFSLPFWGYYAADQWVFGLGLCKMISWMYLVGFYSGIFFVMLMSIDRYLAIVHAVFSLRARTLTYGVITSLATWSVAVFASLPGFLFSTCYTERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTLQHCKNEKKNKAVKMIFAVVVLFLGFW
Measured by its binding ability in a functional ELISA. Immobilized Human CCR4 at 10 µg/mL can bind Anti-CCR4 recombinant antibody(CSB-RA004843MA01HU), the EC50 is 362.3-630.8 ng/mL.
The presence of VLP-like structures was confirmed by TEM
CSB-MP004843HU is detected by Mouse anti-6*His monoclonal antibody.