Recombinant Human C-C chemokine receptor type 4 (CCR4)-VLPs (Active)

Produktübersicht

• Artikelname: Recombinant Human C-C chemokine receptor type 4 (CCR4)-VLPs (Active)
• Artikelnummer: CSB-MP004843HU
• Hersteller Artikelnummer: CSB-MP004843HU
• Alternativnummer: CSB-MP004843HU-1, CSB-MP004843HU-100, CSB-MP004843HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: K5-5 CD_antigen: CD194

Produkteigenschaften

• Molekulargewicht: 43.2 kDa
• Tag: C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
• UniProt: P51679
• Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4.
• Quelle: Mammalian cell
• Expression System: 1-360aa
• Reinheit: The purity information is not available for VLPs proteins.
• Formulierung: Lyophilized powder
• Sequenz: MNPTDIADTTLDESIYSNYYLYESIPKPCTKEGIKAFGELFLPPLYSLVFVFGLLGNSVVVLVLFKYKRLRSMTDVYLLNLAISDLLFVFSLPFWGYYAADQWVFGLGLCKMISWMYLVGFYSGIFFVMLMSIDRYLAIVHAVFSLRARTLTYGVITSLATWSVAVFASLPGFLFSTCYTERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTLQHCKNEKKNKAVKMIFAVVVLFLGFW

Bilder

Measured by its binding ability in a functional ELISA. Immobilized Human CCR4 at 10 µg/mL can bind Anti-CCR4 recombinant antibody(CSB-RA004843MA01HU), the EC50 is 362.3-630.8 ng/mL.

The presence of VLP-like structures was confirmed by TEM

CSB-MP004843HU is detected by Mouse anti-6*His monoclonal antibody.