Recombinant Mouse Dipeptidase 3 (Dpep3)

Artikelnummer: CSB-MP007125MO
Artikelname: Recombinant Mouse Dipeptidase 3 (Dpep3)
Artikelnummer: CSB-MP007125MO
Hersteller Artikelnummer: CSB-MP007125MO
Alternativnummer: CSB-MP007125MO-1, CSB-MP007125MO-100, CSB-MP007125MO-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Membrane-bound dipeptidase 3,MBD-3,Protein expressed in male leptotene and zygotene spermatocytes 136,MLZ-136
Molekulargewicht: 48.7 kDa
Tag: C-terminal 10xHis-tagged
UniProt: Q9DA79
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mammalian cell
Expression System: 36-462aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: TCTLTTPSPSSAPTTPEASNATTAPGIPNDTATSGVTSDPRLREQALALMRDFPLVDGHNDLPLLLRELFQNQLQDVNLRNFTRGQTNLDRLRDGLVGAQFWSAYIPCQTQDRDAVRLALEQIDLIRRMCSAYPELELVTSADGLNNTQKLACLIGVEGGHSLDTSLAVLRSFYELGVRYLTLTFTCSTPWAESATKFRHHFYTNISGLTSFGEKVVEEMNRLGMMIDLSHASDTLVKQTLEVSQAPVIFSHSAA
The purity of Dpep3 was greater than 95% as determined by SEC-HPLC
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.