Recombinant Rat Tonin (Klk2)

Artikelnummer: CSB-MP012453RAD9
Artikelname: Recombinant Rat Tonin (Klk2)
Artikelnummer: CSB-MP012453RAD9
Hersteller Artikelnummer: CSB-MP012453RAd9
Alternativnummer: CSB-MP012453RAD9-1, CSB-MP012453RAD9-100, CSB-MP012453RAD9-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Esterase 1,Glandular kallikrein-2,RSKG-5,S2 kallikrein
Molekulargewicht: 54.5 kDa
Tag: C-terminal hFc1-tagged
UniProt: P00759
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.265.
Quelle: Mammalian cell
Expression System: 25-259aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: IVGGYKCEKNSQPWQVAVINEYLCGGVLIDPSWVITAAHCYSNNYQVLLGRNNLFKDEPFAQRRLVRQSFRHPDYIPLIVTNDTEQPVHDHSNDLMLLHLSEPADITGGVKVIDLPTKEPKVGSTCLASGWGSTNPSEMVVSHDLQCVNIHLLSNEKCIETYKDNVTDVMLCAGEMEGGKDTCAGDSGGPLICDGVLQGITSGGATPCAKPKTPAIYAKLIKFTSWIKKVMKENP
Anwendungsbeschreibung: Research Areas: Cancer