Recombinant Human Growth/differentiation factor 8 (MSTN)

Artikelnummer: CSB-MP015057HU(A4)D7
Artikelname: Recombinant Human Growth/differentiation factor 8 (MSTN)
Artikelnummer: CSB-MP015057HU(A4)D7
Hersteller Artikelnummer: CSB-MP015057HU(A4)d7
Alternativnummer: CSB-MP015057HU(A4)D7-1, CSB-MP015057HU(A4)D7-100, CSB-MP015057HU(A4)D7-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Myostatin
Molekulargewicht: 42.1 kDa
Tag: C-terminal 10xHis-tagged
UniProt: O14793
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.61.
Quelle: Mammalian cell
Expression System: 24-375aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: NENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTE
Anwendungsbeschreibung: Research Areas: Signal Transduction