Recombinant Saccharomyces cerevisiae Lipid-anchored plasma membrane protein CPP1 (CPP1)

Artikelnummer: CSB-MP334389SVG
Artikelname: Recombinant Saccharomyces cerevisiae Lipid-anchored plasma membrane protein CPP1 (CPP1)
Artikelnummer: CSB-MP334389SVG
Hersteller Artikelnummer: CSB-MP334389SVG
Alternativnummer: CSB-MP334389SVG-1, CSB-MP334389SVG-100, CSB-MP334389SVG-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: C-terminally palmitoylated protein CPP1,Cysteine-rich protein CPP1
Molekulargewicht: 82.6 kDa
Tag: C-terminal 10xHis-HSA-tagged
UniProt: P38216
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mammalian cell
Expression System: 2-128aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SANDYYGGTAGEKSQYSRPSNPPPSSAHQNKTQERGYPPQQQQQYYQQQQQHPGYYNQQGYNQQGYNQQGYNQQGYNQQGYNQQGYNQQGHQQPVYVQQQPPQRGNEGCLAACLAALCICCTMDMLF
Anwendungsbeschreibung: Research Areas: Others