Recombinant Human Putative butyrophilin-like protein 10 pseudogene (BTNL10P), partial

Artikelnummer: CSB-MP4804HU
Artikelname: Recombinant Human Putative butyrophilin-like protein 10 pseudogene (BTNL10P), partial
Artikelnummer: CSB-MP4804HU
Hersteller Artikelnummer: CSB-MP4804HU
Alternativnummer: CSB-MP4804HU-1, CSB-MP4804HU-100, CSB-MP4804HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Molekulargewicht: 93.6 kDa
Tag: C-terminal 10xHis-HSA-tagged
UniProt: A8MVZ5
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.11.
Quelle: Mammalian cell
Expression System: 27-254aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SIWKADFDVTGPHAPILAMAGGHVELQCQLFPNISAEDMELRWYRCQPSLAVHMHERGMDMDGEQKWQYRGRTTFMSDHVARGKAMVRSHRVTTFDNRTYCCRFKDGVKFGEATVQVQVAGLGREPRIQVTDQQDGVRAECTSAGCFPKSWVERRDFRGQARPAVTNLSASATTRLWAVASSLTLWDRAVEGLSCSISSPLLPERRKVAESHLPATFSRSSQFTAWKA
Anwendungsbeschreibung: Research Areas: Immunology