Recombinant Human Putative butyrophilin-like protein 10 pseudogene (BTNL10P), partial

Artikelnummer: CSB-MP4804HUD9
Artikelname: Recombinant Human Putative butyrophilin-like protein 10 pseudogene (BTNL10P), partial
Artikelnummer: CSB-MP4804HUD9
Hersteller Artikelnummer: CSB-MP4804HUd9
Alternativnummer: CSB-MP4804HUD9-1, CSB-MP4804HUD9-100, CSB-MP4804HUD9-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Molekulargewicht: 54.5 kDa
Tag: C-terminal hFc1-tagged
UniProt: A8MVZ5
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.35.
Quelle: Mammalian cell
Expression System: 27-254aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SIWKADFDVTGPHAPILAMAGGHVELQCQLFPNISAEDMELRWYRCQPSLAVHMHERGMDMDGEQKWQYRGRTTFMSDHVARGKAMVRSHRVTTFDNRTYCCRFKDGVKFGEATVQVQVAGLGREPRIQVTDQQDGVRAECTSAGCFPKSWVERRDFRGQARPAVTNLSASATTRLWAVASSLTLWDRAVEGLSCSISSPLLPERRKVAESHLPATFSRSSQFTAWKA
Anwendungsbeschreibung: Research Areas: Immunology