Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 (NDUFA5)

Artikelnummer: CSB-MP614988HU
Artikelname: Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 (NDUFA5)
Artikelnummer: CSB-MP614988HU
Hersteller Artikelnummer: CSB-MP614988HU
Alternativnummer: CSB-MP614988HU-1, CSB-MP614988HU-100, CSB-MP614988HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Complex I subunit B13,Complex I-13kD-B,NADH-ubiquinone oxidoreductase 13 kDa-B subunit
Molekulargewicht: 15.5 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q16718
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mammalian cell
Expression System: 2-116aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
Anwendungsbeschreibung: Research Areas: Cancer