Recombinant Mouse Putative phospholipase B-like 2 (Plbd2)

Artikelnummer: CSB-MP663623MO
Artikelname: Recombinant Mouse Putative phospholipase B-like 2 (Plbd2)
Artikelnummer: CSB-MP663623MO
Hersteller Artikelnummer: CSB-MP663623MO
Alternativnummer: CSB-MP663623MO-1, CSB-MP663623MO-100, CSB-MP663623MO-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: 66.3KDA protein76KDA protein ,p76LAMA-like protein 2Lamina ancestor homolog 2,Phospholipase B domain-containing protein 2
Molekulargewicht: 65.9 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q3TCN2
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mammalian cell
Expression System: 47-594aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LPTLGPGWQRQNPDPPVSRTRSLLLDAASGQLRLEDGFHPDAVAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTNTKPSLGSGSCSALIKLLPGGHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLVAGNN
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.