Recombinant Human BTB/POZ domain-containing protein KCTD21 (KCTD21)

Artikelnummer: CSB-MP673458HUR10
Artikelname: Recombinant Human BTB/POZ domain-containing protein KCTD21 (KCTD21)
Artikelnummer: CSB-MP673458HUR10
Hersteller Artikelnummer: CSB-MP673458HUr10
Alternativnummer: CSB-MP673458HUR10-1, CSB-MP673458HUR10-100, CSB-MP673458HUR10-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: KCASH2 protein,Potassium channel tetramerization domain-containing protein 21
Molekulargewicht: 97.7 kDa
Tag: C-terminal 10xHis-HSA-tagged
UniProt: Q4G0X4
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.65.
Quelle: Mammalian cell
Expression System: 1-260aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSDPITLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKRDSQGNCFIDRDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKEVELSKAEKNAMLNITLNQRVQTVHFTVREAPQIYSLSSSSMEVFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPNHLTLDWVANVEGLPEEEYTKQNLKRLWVVPANKQINSFQVFVEEVLKIALSDGFCIDSSHPHALDFMNNKIIR
Anwendungsbeschreibung: Research Areas: Cell Biology