Recombinant Human FERM domain-containing protein 5 (FRMD5)

Artikelnummer: CSB-MP7056HU
Artikelname: Recombinant Human FERM domain-containing protein 5 (FRMD5)
Artikelnummer: CSB-MP7056HU
Hersteller Artikelnummer: CSB-MP7056HU
Alternativnummer: CSB-MP7056HU-1, CSB-MP7056HU-100, CSB-MP7056HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Molekulargewicht: 60.6 kDa
Tag: C-terminal 6xHis-tagged
UniProt: B5MC67
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mammalian cell
Expression System: 1-517aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MLSRLMSGSSRSLEREYSCTVRLLDDSEYTCTIQRDAKGQYLFDLLCHHLNLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLRSQPPFTMCFRVKFYPADPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDSGKHPEGYSSKFQFFPKHSEKLERKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKT
Anwendungsbeschreibung: Research Areas: Cancer