Recombinant Pig tissue kallikrein (KLK5), partial

Artikelnummer: CSB-MP7460PID7
Artikelname: Recombinant Pig tissue kallikrein (KLK5), partial
Artikelnummer: CSB-MP7460PID7
Hersteller Artikelnummer: CSB-MP7460PId7
Alternativnummer: CSB-MP7460PID7-1, CSB-MP7460PID7-100, CSB-MP7460PID7-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Molekulargewicht: 27.7 kDa
Tag: C-terminal 10xHis-tagged
UniProt: A0A286ZS23
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mammalian cell
Expression System: 71-297aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: IVNGTDCGMNSQPWQGALLMKPNQLYCGAVLVNPQWLLTAAHCRKEFFRIRLGHYSLSPTYEAGQQLFQGIKSIPHPGYSHPSHSNDLMLIKLNRKIHKTQAVRPINISSHCPTAGTRCLVSGWGTTSSPQVKYPDVLQCLNITVLSEDRCKKAYPNQIDATMFCAGDQVGRDSCQGDSGGPVVCHGTLQGLVSWGDSPCAKPNRPGVYTNLCQFTKWIQDTIQSNS
Anwendungsbeschreibung: Research Areas: Others