Recombinant Human Killer cell immunoglobulin-like receptor 3DL3 (KIR3DL3), partial, Biotinylated

Artikelnummer: CSB-MP850818HUJ8-B
Artikelname: Recombinant Human Killer cell immunoglobulin-like receptor 3DL3 (KIR3DL3), partial, Biotinylated
Artikelnummer: CSB-MP850818HUJ8-B
Hersteller Artikelnummer: CSB-MP850818HUj8-B
Alternativnummer: CSB-MP850818HUJ8-B-1, CSB-MP850818HUJ8-B-100, CSB-MP850818HUJ8-B-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: CD158 antigen-like family member Z,Killer cell inhibitory receptor 1
Molekulargewicht: 62.9 kDa
Tag: C-terminal hFc-Avi-tagged
UniProt: Q8N743
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.167.
Quelle: Mammalian cell
Expression System: 26-322aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QDKPFLSAWPGTVVSEGQHVTLQCRSRLGFNEFSLSKEDGMPVPELYNRIFRNSFLMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGVHRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGITEDPLRLVGQLHDAGSQVNYSMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYGKPSLSAQPGPTVQAGENVTLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANF
Anwendungsbeschreibung: Research Areas: Immunology