Recombinant Human Golgin subfamily A member 6-like protein 24 (GG6LX), partial Preis auf Anfrage

Artikelnummer: CSB-MP979288HU
Artikelname: Recombinant Human Golgin subfamily A member 6-like protein 24 (GG6LX), partial Preis auf Anfrage
Artikelnummer: CSB-MP979288HU
Hersteller Artikelnummer: CSB-MP979288HU
Alternativnummer: CSB-MP979288HU-20, CSB-MP979288HU-100, CSB-MP979288HU-1
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: Golgin subfamily A member 6-like protein 24 GOLGA6L24
Molekulargewicht: /
Tag: Tag type will be determined during the manufacturing process. (Note:If you have specified tag type, please tell us or remark on your PO and we will develop the specified tag preferentially.)
UniProt: P0DX00
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: Partial
Target-Kategorie: MWPQPHLPTHPHLPTHPHLPTHPHLPTHPHLPTHPMMSKETRQSKLAEAKEQLTDHHPQTNPSVGTAASDTKKKKINNGTNPETTTSGGCHSPEDEQKASHQHQEALRRELEAQVQTIRILTCQKTELQMALYYSQHAVKQLEGEARDLISRLHDSWKFAGELEQALSAVATQKKKADRYIEELTKERDALSLELYRNTITDEELKEKNAKLQEKLQLVESEKSEIQLNVKELKRKLERAKLLLPQQQLQAEADH
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.