Recombinant Bovine Beta-arrestin-2 (ARRB2)

Produktübersicht

• Artikelname: Recombinant Bovine Beta-arrestin-2 (ARRB2)
• Artikelnummer: CSB-YP002135BO
• Hersteller Artikelnummer: CSB-YP002135BO
• Alternativnummer: CSB-YP002135BO-1, CSB-YP002135BO-100, CSB-YP002135BO-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Arrestin beta-2,Arrestin-3

Produkteigenschaften

• Molekulargewicht: 48.7 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: P32120
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1-420aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLFIANYQAFPPTPNPPRPPTRLQERLLRKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVA