Recombinant Human Arylsulfatase B (ARSB)

Artikelnummer: CSB-YP002142HU
Artikelname: Recombinant Human Arylsulfatase B (ARSB)
Artikelnummer: CSB-YP002142HU
Hersteller Artikelnummer: CSB-YP002142HU
Alternativnummer: CSB-YP002142HU-1, CSB-YP002142HU-100, CSB-YP002142HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: N-acetylgalactosamine-4-sulfatase ,G4S
Molekulargewicht: 58 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P15848
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 37-533aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWN
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.