Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial (Active)

Produktübersicht

• Artikelname: Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial (Active)
• Artikelnummer: CSB-YP023924HU
• Hersteller Artikelnummer: CSB-YP023924HU
• Alternativnummer: CSB-YP023924HU-1, CSB-YP023924HU-100, CSB-YP023924HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: /

Produkteigenschaften

• Molekulargewicht: 44.8 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: O15393
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 106-492aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDL

Bilder

Recombinant Human TMPRSS2 His tag protein (CSB-YP023924HU) enzyme activity is measured by its ability to cleave fluorogenic peptide substrate(Boc-Gln-Ala-Arg-AMC), The Km is 21.93µM.②Measured by Camostat Mesylate inhibit ratio on TMPRSS2 (CSB-YP023924HU), which can cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC). The Camostat Mesylate inhibit EC50 is 0.03347-0.07945µM.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.