Recombinant Klebsiella pneumoniae Fimbrial subunit type 3 (mrkA)

Artikelnummer: CSB-YP318939KBGC7
Artikelname: Recombinant Klebsiella pneumoniae Fimbrial subunit type 3 (mrkA)
Artikelnummer: CSB-YP318939KBGC7
Hersteller Artikelnummer: CSB-YP318939KBGc7
Alternativnummer: CSB-YP318939KBGC7-1, CSB-YP318939KBGC7-100, CSB-YP318939KBGC7-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Molekulargewicht: 20.0 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P12267
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 23-202aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ADTNVGGGQVNFFGKVTDVSCTVSVNGQGSDANVYLSPVTLTEVKAAAADTYLKPKSFTIDVSDCQAADGTKQDDVSKLGVNWTGGNLLAGATAKQQGYLANTEAAGAQNIQLVLSTDNATALTNKIIPGDSTQPKAAGDASAVQDGARFTYYVGYATSTPTTVTTGVVNSYATYEITYQ
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.