Recombinant Aspergillus niger Contig An12c0300, genomic contig (An12g08930)

Produktübersicht

• Artikelname: Recombinant Aspergillus niger Contig An12c0300, genomic contig (An12g08930)
• Artikelnummer: CSB-YP4653AVE
• Hersteller Artikelnummer: CSB-YP4653AVE
• Alternativnummer: CSB-YP4653AVE-1, CSB-YP4653AVE-100, CSB-YP4653AVE-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide

Produkteigenschaften

• Molekulargewicht: 45.4 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: A2R0K6
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1-395aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MALAYSNIPLGATVIPSPFQVHISDEQIEELQLLVKLSKLAPPTYEGLQQDRRYGITNEWLANAKEAWKSFDWRPAESRINSFPQFTYDIEGLTIHFVALFSEKKDAIPIVLLHGWPGSFLEFLPVLTSIRDKYSPETLPYHIVVPSLPGFTFSSGPPLDVNFNGEDTARVINKVMLNLGFEDGYVAQGGDIGSKIGRILAVDHDACKAVHLNACYMGKPSSIPDTAITEEDKRALARAQWFATFGSGYAVEHGT