Recombinant Klebsiella pneumoniae Outer-membrane lipoprotein carrier protein (lolA)

Produktübersicht

• Artikelname: Recombinant Klebsiella pneumoniae Outer-membrane lipoprotein carrier protein (lolA)
• Artikelnummer: CSB-YP466668KBH
• Hersteller Artikelnummer: CSB-YP466668KBH
• Alternativnummer: CSB-YP466668KBH-1, CSB-YP466668KBH-100, CSB-YP466668KBH-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide

Produkteigenschaften

• Molekulargewicht: 22.1 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: B5XYA1
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 22-203aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: DAASDLKSRLDKVSSFHASFTQKVTDGSGNAVQDGQGDLWVKRPNLFNWHMTQPDESVLVSDGKTLWFYNPFVEQATATWLKDATSNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKSGSGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDASKFTFTPPKGVTVDDQRK