Recombinant Hepatitis C virus genotype 1b Genome polyprotein, partial
Artikelnummer:
CSB-YP530838HVQ(A3)
- Bilder (1)
| Artikelname: | Recombinant Hepatitis C virus genotype 1b Genome polyprotein, partial |
| Artikelnummer: | CSB-YP530838HVQ(A3) |
| Hersteller Artikelnummer: | CSB-YP530838HVQ(A3) |
| Alternativnummer: | CSB-YP530838HVQ(A3)-1, CSB-YP530838HVQ(A3)-100, CSB-YP530838HVQ(A3)-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Genome polyprotein [Cleaved into: Core protein p21, Capsid protein C, p21), Core protein p19, Envelope glycoprotein E1, gp32, gp35), Envelope glycoprotein E2, NS1, gp68, gp70), p7, Protease NS2-3, p23, EC 3.4.22.-), Serine protease NS3, EC 3.4.21.98, EC 3.6.1.15, EC 3.6.4.13, Hepacivirin, NS3P, p70), Non-structural protein 4A, NS4A, p8), Non-structural protein 4B, NS4B, p27), Non-structural protein 5A, NS5A, p56), RNA-directed RNA polymerase, EC 2.7.7.48, NS5B, p68)] |
| Molekulargewicht: | 21.2 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | O92972 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 2-177aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | STNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKASERSQPRGRRQPIPKARRPEGRAWAQPGYPWPLYGNEGLGWAGWLLSPRGSRPSWGPTDPRRRSRNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSIF |

-SDS.jpg)