Recombinant Human Ly6/PLAUR domain-containing protein 1 (LYPD1)

Artikelnummer: CSB-YP843142HU
Artikelname: Recombinant Human Ly6/PLAUR domain-containing protein 1 (LYPD1)
Artikelnummer: CSB-YP843142HU
Hersteller Artikelnummer: CSB-YP843142HU
Alternativnummer: CSB-YP843142HU-1, CSB-YP843142HU-100, CSB-YP843142HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Putative HeLa tumor suppressor
Molekulargewicht: 11.8 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q8N2G4
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 21-117aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LQIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSS
Anwendungsbeschreibung: Research Areas: Cancer