Recombinant Human Armadillo repeat-containing X-linked protein 3 (ARMX3), partial Preis auf Anfrage

Artikelnummer: CSB-YP967371HU
Artikelname: Recombinant Human Armadillo repeat-containing X-linked protein 3 (ARMX3), partial Preis auf Anfrage
Artikelnummer: CSB-YP967371HU
Hersteller Artikelnummer: CSB-YP967371HU
Alternativnummer: CSB-YP967371HU-20, CSB-YP967371HU-100, CSB-YP967371HU-1
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: Armadillo repeat-containing X-linked protein 3, ARM protein lost in epithelial cancers on chromosome X 3, Protein ALEX3, ARMCX3 ALEX3 BM-017 UNQ2517/PRO6007
Molekulargewicht: /
Tag: Tag type will be determined during the manufacturing process. (Note:If you have specified tag type, please tell us or remark on your PO and we will develop the specified tag preferentially.)
UniProt: Q9UH62
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: Partial
Target-Kategorie: GRKQNKEKMAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDDTITSRLNSSVQLAGLRLLTNMTVTNEYQHMLANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQ
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.