Recombinant Human T cell receptor alpha variable 1-2 (TVA12) Preis auf Anfrage

Produktübersicht

• Artikelname: Recombinant Human T cell receptor alpha variable 1-2 (TVA12) Preis auf Anfrage
• Artikelnummer: CSB-YP991785HU
• Hersteller Artikelnummer: CSB-YP991785HU
• Alternativnummer: CSB-YP991785HU-20, CSB-YP991785HU-100, CSB-YP991785HU-1
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Alternative Synonym: T cell receptor alpha variable 1-2 TRAV1-2

Produkteigenschaften

• Molekulargewicht: /
• Tag: Tag type will be determined during the manufacturing process. (Note:If you have specified tag type, please tell us or remark on your PO and we will develop the specified tag preferentially.)
• UniProt: A0A0B4J238
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: Full Length of Mature Protein
• Target-Kategorie: QNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCA

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.