CAS Number: 115966-23-9Molecular Weight: 3505.7Salt Form: TFAPurity: >96%Sequence (3-letter): Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OHSequence (1-letter): TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY-OHStorage: -20 AC or belowUrodilatin is a cardiovascular hormone which causes sodium excretion in urine (natriuresis) by increasing renal blood flow. It is secreted in the kidney in response to increasing mean arterial pressure.
Tag:
1178
CAS Nummer:
[115966-23-9]
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten