Calcitonin Gene Related Peptide II (CGRP II, human), cyclic

Artikelnummer: ECH-231-29
Artikelname: Calcitonin Gene Related Peptide II (CGRP II, human), cyclic
Artikelnummer: ECH-231-29
Hersteller Artikelnummer: 231-29
Alternativnummer: ECH-231-29-0.5MG, ECH-231-29-1MG
Hersteller: Echelon Biosciences
Kategorie: Molekularbiologie
CAS Number: 98824-26-1 Molecular Weight: 3792.94 Salt Form: TFA Purity: >95% Sequence (3-letter): Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2 [Cys2-Cys7] Sequence (1-letter): ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 Storage: -20 ?C or below Calcitonin Gene Related Peptide (CGRP) is produced in central and peripheral neurons and binds to the herterodimeric CGRP receptors found throughout the body. It has roles in modulating the autonomic nervous system, appetite suppression, gastric acid release, temperature homeostasis, and heart rate. CGRP exists in two forms CGRP I (CGRP&alpha,) and CGRP II (CGRP&beta,)
Anwendungsbeschreibung: Categories: Peptides. Related: Calcitonin Gene Peptides. Ship 1 : Shipping Temp. Ship 2: Ambient Temperature