Parathyroid Hormone (PTH) (1-34), human

Artikelnummer: ECH-231-40
Artikelname: Parathyroid Hormone (PTH) (1-34), human
Artikelnummer: ECH-231-40
Hersteller Artikelnummer: 231-40
Alternativnummer: ECH-231-40-0.5MG, ECH-231-40-1MG
Hersteller: Echelon Biosciences
Kategorie: Molekularbiologie
CAS Number: 52232-67-4 Molecular Weight: 4115.16 Salt Form: TFA Purity: >96% Sequence (3-letter): Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH Sequence (1-letter): SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OH Storage: -20 ?C or below PTH (1-34) is a bioactive fragment of the full length Parathyroid Hormone. PTH regulates serum calcium levels through its effects in the kidney, intestines, and bones. When serum calcium levels are low, PTH is secreted by the chief cells of the parathyroid gland, stimulating osteoclast activity and bone resorption thus the release of calcium.
Anwendungsbeschreibung: Categories: Peptides. Related: Neuropeptides & Hormones. Ship 1 : Shipping Temp. Ship 2: Ambient Temperature