Parathyroid Hormone (PTH) (2-34) human, CAS [[247902-18-7]]

Artikelnummer: ECH-231-43-1MG
Artikelname: Parathyroid Hormone (PTH) (2-34) human, CAS [[247902-18-7]]
Artikelnummer: ECH-231-43-1MG
Hersteller Artikelnummer: 231-43-1mg
Alternativnummer: ECH-231-43-1MG
Hersteller: Echelon Biosciences
Kategorie: Molekularbiologie
CAS Number: 247902-18-7Molecular Weight: 4028.13Salt Form: TFAPurity: >96%Sequence (3-letter): Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OHSequence (1-letter): VSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OHStorage: -20 AC or belowParathyroid Hormone (PTH) regulates serum calcium levels through its effects in the kidney intestines and bones. When serum calcium levels are low PTH is secreted by the chief cells of the parathyroid gland stimulating osteoclast activity and bone resorption thus the release of calcium. Measuring serum or plasma PTH levels is important for patients in chronic renal failure. Synthetic N-terminal truncated PTH peptides [e.g. PTH(2a€''34) PTH(3a€''34) and PTH(7a€''84)] do not crossa€react with the detection antibodies used in seconda€generation PTH assays.
Tag: 1178
CAS Nummer: [247902-18-7]