Parathyroid Hormone (PTH) (5-34) human

Produktübersicht

• Artikelname: Parathyroid Hormone (PTH) (5-34) human
• Artikelnummer: ECH-231-51-1MG
• Hersteller Artikelnummer: 231-51-1mg
• Alternativnummer: ECH-231-51-1MG
• Hersteller: Echelon Biosciences
• Kategorie: Molekularbiologie

Produktbeschreibung

Molecular Weight: 3712.99Salt Form: TFAPurity: >96%Sequence (3-letter): Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OHSequence (1-letter): IQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OHStorage: -20 AC or belowParathyroid Hormone (PTH) (5-34) is a N-terminal truncated form of the full length PTH. PTH regulates serum calcium levels through its effects in the kidney intestines and bones. When serum calcium levels are low PTH is secreted by the chief cells of the parathyroid gland stimulating osteoclast activity and bone resorption thus the release of calcium.

Produkteigenschaften

• Tag: 1178