Glucagon-like Peptide-2 (GLP-2) human / Preproglucagon (126-158) human, CAS [[223460-79-5]]

Produktübersicht

• Artikelname: Glucagon-like Peptide-2 (GLP-2) human / Preproglucagon (126-158) human, CAS [[223460-79-5]]
• Artikelnummer: ECH-471-18-0.5MG
• Hersteller Artikelnummer: 471-18-0.5mg
• Alternativnummer: ECH-471-18-0.5MG
• Hersteller: Echelon Biosciences
• Kategorie: Molekularbiologie

Produktbeschreibung

CAS Number: 223460-79-5Molecular Weight: 3763.82Salt Form: TFAPurity: >96%Sequence (3-letter): His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OHSequence (1-letter): HADGSFSDEMNTILDNLAARDFINWLIQTKITD-OHStorage: -20 AC or belowGlucagon-like Peptide-2 (GLP-2) is a 33-amino acid peptide formed through post-translational proteolytic cleavage of proglucagon. GLP-2 produces a number of effects when administered to humans and rodents including intestinal growth enhancement of intestinal function reduction in bone breakdown and neuroprotection. An analog of GLP-2 Teduglutide (cat 471-21) is used to treat short-bowel syndrome.Publication Powered by Bioz See more details on Bioz

Produkteigenschaften

• Tag: 1191 1178
• CAS Nummer: [223460-79-5]