Glucagon-like Peptide-1, human

Produktübersicht

• Artikelname: Glucagon-like Peptide-1, human
• Artikelnummer: ECH-471-26
• Hersteller Artikelnummer: 471-26
• Alternativnummer: ECH-471-26-0.5MG,ECH-471-26-1MG
• Hersteller: Echelon Biosciences
• Kategorie: Molekularbiologie

Produktbeschreibung

CAS Number: 87805-34-3 Molecular Weight: 4167.03 Salt Form: TFA Purity: >95% Sequence (3-letter): His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH Sequence (1-letter): HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH Storage: -20 ?C or below Solubility: water to 5 mg/mL Glucagon-like peptide-1 (GLP-1) is an incretin produced primarily in ileal L cells. GLP-1 secretion by these cells is dependent on the presence of nutrients in the lumen of the small intestine. GLP-1 promotes satiety and sustained GLP-1-receptor activation correlates with weight loss. The biologically active forms of GLP-1 are GLP-1 (7-37) and GLP-1 (7-36)NH2 (cat 471-39 and 471-28, respectively) which are produced as a result of selective cleavage of proglucagon.

References

1. Baggio, L.L. and Drucker, D.J. (2007) ?Biology of Incretins: GLP-1 and GIP? Gastroenterology 132 (6): 2131-57. 2. Kastin, A.J., Akerstrom, V. and Pan, W. (2002) ?Interactions of glucagon-like peptide-1 (GLP-1) with the blood-brain barrier? J. Mol. Neurosci. 18 (1-2): 7-14.

Anwendungsbeschreibung

• Anwendungsbeschreibung: Categories: Peptides. Related: Metabolic / Diabetes, Neuropeptides & Hormones. Ship 1 : Shipping Temp. Ship 2: Ambient Temperature