Glucagon-like Peptide-1 (GLP-1) (7-36) / Preproglucagon (78-107) amide, CAS [[107444-51-9]]

Produktübersicht

• Artikelname: Glucagon-like Peptide-1 (GLP-1) (7-36) / Preproglucagon (78-107) amide, CAS [[107444-51-9]]
• Artikelnummer: ECH-471-28-1MG
• Hersteller Artikelnummer: 471-28-1mg
• Alternativnummer: ECH-471-28-1MG
• Hersteller: Echelon Biosciences
• Kategorie: Molekularbiologie

Produktbeschreibung

CAS Number: 107444-51-9Molecular Weight: 3297.69Salt Form: TFAPurity: >95%Sequence (3-letter): His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2Sequence (1-letter): HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2Storage: -20 AC or belowGlucagon-like Peptide-1 (7-36) is one the two primary biologically active forms of secreted glucagon-like peptide-1 (GLP-1). GLP-1 is secreted as a pro-peptide that is then proteolytically cleaved into two active forms (7-37) and (7-36). These active peptides can promote insulin secretion in a glucose-dependent manner.

Produkteigenschaften

• Tag: 1196 1178
• CAS Nummer: [107444-51-9]