Pancreatic Polypeptide avian

Artikelnummer: ECH-478-40-0.5MG
Artikelname: Pancreatic Polypeptide avian
Artikelnummer: ECH-478-40-0.5MG
Hersteller Artikelnummer: 478-40-0.5mg
Alternativnummer: ECH-478-40-0.5MG
Hersteller: Echelon Biosciences
Kategorie: Molekularbiologie
Molecular Weight: 4235.09Salt Form: TFAPurity: >95%Sequence (3-letter): Gly-Pro-Ser-Gln-Pro-Thr-Tyr-Pro-Gly-Asp-Asp-Ala-Pro-Val-Glu-Asp-Leu-Ile-Arg-Phe-Tyr-Asp-Asn-Leu-Gln-Gln-Tyr-Leu-Asn-Val-Val-Thr-Arg-His-Arg-Tyr-NH2Sequence (1-letter): GPSQPTYPGDDAPVEDLIRFYDNLQQYLNVVTRHRY-NH2Storage: -20 AC or belowPancreatic Polypeptide (PP) is an agonist at neuropeptide Y receptors. It is a 36-amino-acid secretory peptide that is predominantly produced by the pancreas that affects the secretion of pancreatic enzymes water and electrolytes. It is rapidly released postprandially and continues to remain elevated for approximately 4-6 hours after a meal.