CAS Number: 123583-37-9 Molecular Weight: 4047.08 Salt Form: TFA Purity: >95% Sequence (3-letter): Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 Sequence (1-letter): IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 Storage: -20 ?C or below Solubility: water >1 mg/mL PYY/Peptide YY (3-36), human is a peptide released by cells in the ileum and colon in response to eating that acts to reduce hunger. PYY acts as a hormonal signal from the gut to the brain to inhibit food intake and promote satiety. Low levels of PYY may be a contributing factor in obesity and binge eating, while elevated levels may contribute to anorexia nervosa and decreased bone turnover.
