CAS Number: 141758-74-9Molecular Weight: 4184.04Salt Form: TFAPurity: >95%Sequence (3-letter): His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2Sequence (1-letter): HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2Storage: -20 AC or belowExendin-4 is an incretin mimetic peptide and A an analog of glucagon-like peptide 1 (GLP-1). The mimetic activity of Exendin-4 controls insulin secretion in a glucose-dependent manner.Publications Powered by Bioz See more details on Bioz
Tag:
1196 1178
CAS Nummer:
[141758-74-9]
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten