Exendin 3, CAS [[130357-25-4]]

Produktübersicht

• Artikelname: Exendin 3, CAS [[130357-25-4]]
• Artikelnummer: ECH-507-79-1MG
• Hersteller Artikelnummer: 507-79-1mg
• Alternativnummer: ECH-507-79-1MG
• Hersteller: Echelon Biosciences
• Kategorie: Molekularbiologie

Produktbeschreibung

CAS Number: 130357-25-4Molecular Weight: 4200.03Salt Form: TFAPurity: >96%Sequence (3-letter): His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2Sequence (1-letter): HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2Storage: -20 AC or belowExendin-3 is a member of the glucagon family that has secretin-like biological activity when binding to the exendin receptor.Publications Powered by Bioz See more details on Bioz

Produkteigenschaften

• Tag: 1196 1178
• CAS Nummer: [130357-25-4]