CAS Number: 90880-35-6 Molecular Weight: 4269.09 Salt Form: TFA Purity: >96% Sequence (3-letter): Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 Sequence (1-letter): YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 Storage: -20 ?C or below Solubility: water 1 mg/mL Neuropeptide Y (NPY) is a peptide that is abundant in the central and peripheral nervous system that plays a major role in controlling appetite, blood pressure, cardiac contractility, and intestinal secretion. NPY is a vasonconstrictor that inhibits Ca2+-activated K+ channels in vascular smooth muscle. Inhibition of NPY synthesis regulates food intake and metabolism implicating a role in obesity. This NPY amino acid sequence is homologous for human, rat, rabbit, and guinea pig.
