Molecular Weight: 4326.19Salt Form: TFAPurity: >95%Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Gln-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OHSequence (1-letter): DAEFRHDSGYQVHHQKLVFFAEDVGSNKGAIIGLMVGGVV(OH)Storage: -20 AC or belowBeta amyloid (1-40) along with beta amyloid (1-42) is one of the two main variants of the amyloid i peptide involved in Alzheimera€(TM)s disease. Beta amyloid (1-40) is a peptide that is found in plaques in the brains of patients with Alzheimera€(TM)s disease and is shown to have both neurotrophic and neurotoxic effects in human and rat cell culture models. This analog has Gln instead of Glu at position 11.
Tag:
1202 1192
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten