Beta Amyloid [Nle35] (1-40) human

Artikelnummer: ECH-641-13-1MG
Artikelname: Beta Amyloid [Nle35] (1-40) human
Artikelnummer: ECH-641-13-1MG
Hersteller Artikelnummer: 641-13-1mg
Alternativnummer: ECH-641-13-1MG
Hersteller: Echelon Biosciences
Kategorie: Molekularbiologie
Molecular Weight: 4309.22Salt Form: TFAPurity: >96%Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Nle-Val-Gly-Gly-Val-Val-OHSequence (1-letter): DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL(Nle)VGGVV-OHStorage: -20 AC or belowBeta amyloid (1-40) along with beta amyloid (1-42) is one of the two main variants of the amyloid i peptide involved in Alzheimera€(TM)s disease. Beta amyloid (1-40) is a peptide that is found in plaques in the brains of patients with Alzheimera€(TM)s disease and is shown to have both neurotrophic and neurotoxic effects in human and rat cell culture models. This analog has Nle instead of Met at position 35 resulting in a peptide that has the same propensity to aggregate but is non-toxic to hippocampal neurons.
Tag: 1202 1192