Beta Amyloid (1-40) human [Gly22] (Arctic mutation), CAS [[175010-18-1]]

Artikelnummer: ECH-641-14-0.5MG
Artikelname: Beta Amyloid (1-40) human [Gly22] (Arctic mutation), CAS [[175010-18-1]]
Artikelnummer: ECH-641-14-0.5MG
Hersteller Artikelnummer: 641-14-0.5mg
Alternativnummer: ECH-641-14-0.5MG
Hersteller: Echelon Biosciences
Kategorie: Molekularbiologie
CAS Number: 175010-18-1Molecular Weight: 4255.16Salt Form: TFAPurity: >95%Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gly-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OHSequence (1-letter): DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV-OHStorage: -20 AC or belowBeta Amyloid (1-40) human [Gly22] (Arctic mutation) causes early onset of Alzheimera€s compared to wild type and promotes protofibril formation and neurotoxicity.A Beta amyloid (1-40) along with beta amyloid (1-42) (catalog 641-15) is one of the two main variants of the amyloid i peptide involved in Alzheimera€(TM)s disease. Beta amyloid (1-40) is a peptide that is found in plaques in the brains of patients with Alzheimera€(TM)s disease and is shown to have both neurotrophic and neurotoxic effects in human and rat cell culture models.
Tag: 1202 1192
CAS Nummer: [175010-18-1]