CAS Number: 166090-74-0Molecular Weight: 4415.26Salt Form: TFAPurity: >95%Sequence (3-letter): Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OHSequence (1-letter): DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OHStorage: -20 AC or belowSolubility: water 1 mg/mlBeta Amyloid (1-42) rat is the rat form of the predominant Beta amyloid peptide found in plaques associated with Alzheimera€(TM)s disease. It is homologous with the mouse peptide. In some animal models cognitive impairment and neurodegenerative disorders that mimic Alzheimers disease can be reproduced by intracerebral or intracerebroventricular administration of beta amyloid peptide. Evidence suggests that oxidative stresses are involved in the mechanism of beta amyloid-induced neurotoxicity and Alzheimera€(TM)s disease pathogenesis. Exposure to beta amyloid increases lipid peroxidation protein oxidation and the formation of hydrogen peroxide in cultured cells. Beta amyloid peptides are also used to study oxidative stress metal binding and mechanisms of protein cross-linking in Alzheimera€(TM)s disease and neurodegeneration.References Powered by Bioz See more details on Bioz1. Glenner G.G. and Wong C.W. (1984) a€Alzheimers disease: initial report of the purification and characterization of a novel cerebrovascular amyloid protein.a€ Biochem. Biophys. Res. Comm. 120: 885.2. Hong L. et al (2010) a€Quantification of the binding properties of Cu2+ to the amyloid beta peptide: coordination spheres for human and rat peptides and implication on Cu2+-induced aggregationa€ J. Phys. Chem. 114(34): 11261-11271.
Tag:
1263 1202 1256 1192 312
CAS Nummer:
[166090-74-0]
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten