TRAIL-R3 (human) polyclonal antibody

Artikelnummer: ENZ-ALX-210-744-C200
Artikelname: TRAIL-R3 (human) polyclonal antibody
Artikelnummer: ENZ-ALX-210-744-C200
Hersteller Artikelnummer: ALX-210-744-C200
Alternativnummer: ENZ-ALX-210-744-C200-200
Hersteller: Enzo Life Sciences
Wirt: Goat
Kategorie: Antikörper
Applikation: FC, ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide corresponding to aa 33-63 (E33VPQQTVAPQQQRHSFKGEECPAGSHRSEHT63) of the extracellular domain of human TRAIL-R3.
Alternative Synonym: TRAIL receptor 3, DcR1, Death Receptor 1, TRID, CD263, TNFRSF 10C, TNF-related apoptosis-inducing ligand receptor 3, Tumor necrosis factor receptor superfamily member 10C
TRAIL-R3 (human) polyclonal antibody
Klonalität: Polyclonal
UniProt: O14798
Reinheit: Epitope-affinity purified IgG.
Formulierung: Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.
Target-Kategorie: TRAIL receptor
Anwendungsbeschreibung: Detects a band of ~33kDa by Western blot.