Toll-like receptor 5 (human) polyclonal antibody

Artikelnummer: ENZ-ALX-210-853-C200
Artikelname: Toll-like receptor 5 (human) polyclonal antibody
Artikelnummer: ENZ-ALX-210-853-C200
Hersteller Artikelnummer: ALX-210-853-C200
Alternativnummer: ENZ-ALX-210-853-C200-200
Hersteller: Enzo Life Sciences
Wirt: Goat
Kategorie: Antikörper
Applikation: ELISA, FC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide corresponding to aa 151-181 (D151LSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ181) of human TLR5 (Toll-like receptor 5).
Alternative Synonym: TLR5, Toll/Interleukin-1 receptor-like gene 3, TIL3
Toll-like receptor 5 (human) polyclonal antibody
Klonalität: Polyclonal
UniProt: O60602
Reinheit: Epitope-affinity purified IgG.
Formulierung: Affinity purified antibody in 10 mM KHPO4, 140 mM NaCl, BSA 1mg/ml and 0.1% sodium azide.
Target-Kategorie: TLR| TLR5