E2F1 Antibody BIOTIN, Biotin, Rabbit, Polyclonal

Artikelnummer: FBX-E2F1N-BIOTIN
Artikelname: E2F1 Antibody BIOTIN, Biotin, Rabbit, Polyclonal
Artikelnummer: FBX-E2F1N-BIOTIN
Hersteller Artikelnummer: E2F1n-BIOTIN
Alternativnummer: FBX-E2F1N-BIOTIN-100
Hersteller: FabGennix
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Synthetic peptide corresponding to amino acids 58-93 of Human E2F1. Sequence: PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD
Konjugation: Biotin
Alternative Synonym: E2F-1, PBR3, PRB-binding protein E2F-1, RBAP1, RBAP-1, RBBP3, RBBP-3, RBP3, retinoblastoma-associated protein 1, retinoblastoma-binding protein 3, transcription factor E2F1
E2F1 Antibody BIOTIN
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 1869
UniProt: Q01094
Reinheit: Affinity Purified
Target-Kategorie: E2F1
E2F1n-BIOTIN