MMP8 antibody, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: MMP8 antibody, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: GTX03673
• Hersteller Artikelnummer: GTX03673
• Alternativnummer: GTX03673-100
• Hersteller: GeneTex
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of mouse MMP-8 (120-157aa HTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEAD), different from the related human sequence by eleven amino acids, and from the related rat sequence by nine amino acids.
• Konjugation: Unconjugated

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molekulargewicht: 53
• NCBI: 17394
• UniProt: O70138
• Puffer: 0.9 mg NaCl, 0.2 mg Na2HPO4, 5mg BSA, 0.05mg sodium azide.
• Formulierung: Liquid

Anwendungsbeschreibung

• Anwendungsbeschreibung: WB: 0.1-0.5µg/ml. IHC-P: 0.5-1µg/m. ELISA: 0.1-0.5µg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.