Cecropin A, CAS [[80451-04-3]]

Artikelnummer: ISC-AM-080
Artikelname: Cecropin A, CAS [[80451-04-3]]
Artikelnummer: ISC-AM-080
Hersteller Artikelnummer: AM-080
Alternativnummer: ISC-AM-080
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: CeA
Cecropin A (CeA) is a natural linear cationic alpha-helical antimicrobial peptide (AMP) originally identified in moths (Hyalophora cecropia) and later in pig intestine. Cecropin A contains a strongly cationic region at its N-terminus and a large hydrophobic tail at its C-terminus, which allow its interaction with the microbial membrane, and then cell lysis by pore formation. Cecropin A has a wide spectrum of antimicrobial activities against gram-negative bacteria, gram-positive bacteria, and fungal phytopathogens. Cecropins constitute a main part of the innate immune system of insects.
Molekulargewicht: 4003.8
NCBI: 2007
Reinheit: >95% by HPLC
Formulierung: Freeze dried solid
Sequenz: KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
CAS Nummer: [80451-04-3]
Formel: C184H313N53O46
Target-Kategorie: Antibacterials,Antifungals
Anwendungsbeschreibung: ProductType: Antimicrobial peptides