Cecropin B, CAS [[80451-05-4]]

Artikelnummer: ISC-AM-081
Artikelname: Cecropin B, CAS [[80451-05-4]]
Artikelnummer: ISC-AM-081
Hersteller Artikelnummer: AM-081
Alternativnummer: ISC-AM-081
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Cecropin B is a natural linear cationic alpha-helical antimicrobial peptide (AMP) originally identified in insects. Cecropin B has a wide spectrum of antimicrobial activities against gram-negative bacteria, gram-positive bacteria, and fungal phytopathogens, killing bacteria by affecting the integrity of the bacterial membranes. Cecropins constitute a main part of the innate immune system of insects.
Molekulargewicht: 3834.7
NCBI: 2007
Reinheit: >95% by HPLC
Formulierung: Freeze dried solid
Sequenz: KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
CAS Nummer: [80451-05-4]
Formel: C176H302N52O41S
Target-Kategorie: Antibacterials,Antifungals
Anwendungsbeschreibung: ProductType: Antimicrobial peptides