LL 37 (human) biotinylated, pegylated

Artikelnummer: ISC-AM-200
Artikelname: LL 37 (human) biotinylated, pegylated
Artikelnummer: ISC-AM-200
Hersteller Artikelnummer: AM-200
Alternativnummer: ISC-AM-200
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
LL 37 (human) biotinylated, pegylated is the N-terminally biotinylated version of the host defence peptide LL 37 with a biotin group attached via a pegylated chain, PEG(4). The presence of the biotin tag allows numerous biochemical and microbiological ap
Molekulargewicht: 4967
NCBI: 2013
Reinheit: >95% by HPLC
Formulierung: Freeze dried solid
Sequenz: Biotin-[PEG(4)][LL-37, 37 aa]
Formel: C226H376N64O59S
Target-Kategorie: Antibacterials
Anwendungsbeschreibung: ProductType: Biotin labelled peptides