Melittin, C-terminal cysteine labelled

Artikelnummer: ISC-AM-210
Artikelname: Melittin, C-terminal cysteine labelled
Artikelnummer: ISC-AM-210
Hersteller Artikelnummer: AM-210
Alternativnummer: ISC-AM-210
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Melittin, C-terminal cysteine labelled is synthetic melittin with an extra cysteine residue at the C terminal. Melittin is a cationic, haemolytic component of honey bee venom used to study cell and liposome lysis. Melittin is a positively charged, amphipathic 26-amino-acid peptide that associates with the phospholipids of membrane bilayers, causing cell death by forming transmembrane toroidal pores at nanomolar concentrations. Melittin, C-terminal cysteine labelled, can be labelled with any maleimide linked tag to generate fluorescent or biotinylated derivatives.
Molekulargewicht: 2949.63
NCBI: 1998
Reinheit: >95% by HPLC
Formulierung: Freeze dried solid
Sequenz: GIGAVLKVLTTGLPALISWIKRKRQQC-NH2
Formel: C134H234N40O32S
Target-Kategorie: Antibacterials
Anwendungsbeschreibung: ProductType: Antimicrobial peptides