SFKEELDKYFKNHTSP

Artikelnummer: ISC-EP-020
Artikelname: SFKEELDKYFKNHTSP
Artikelnummer: ISC-EP-020
Hersteller Artikelnummer: EP-020
Alternativnummer: ISC-EP-020
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: truncated P4, 1147SFKEELDKYFKNHTSP1162
SFKEELDKYFKNHTSP is a truncated peptide derived from the P4 peptide of the S2 subunit of the S protein of SARS-CoV-2 which has the the amino acid sequence DPLQPELDSFKEELDKYFKNHTSPDVDLGDIS, corresponding to residues 1139-1170. The P4 peptide is located in the linker region between heptad repeat 1 (HR1) and heptad repeat 2 (HR2) and is highly conserved among SARS-CoV, BatCoV RaTG13, SARS-CoV-2 and recent SARS-CoV-2 variants. Antibodies targeting the peptide SFKEELDKYFKNHTSP can neutralize both SARS-CoV-2 and SARS-CoV by preventing fusion between the virus and the cell membrane.
Molekulargewicht: 1970.16
NCBI: 2021
Reinheit: >95% by hplc
Formulierung: Freeze dried solid
Sequenz: H-Ser-Phe-Lys-Glu-Glu-Leu-Asp-Lys-Tyr-Phe-Lys-Asn-His-Thr-Ser-Pro-OH
Formel: C90 H132N22O28
Target-Kategorie: Antivirals,Epitopes
Anwendungsbeschreibung: ProductType: Peptides